PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA14G00038
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family MYB
Protein Properties Length: 353aa    MW: 40437.1 Da    PI: 8.7244
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA14G00038genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding46.21.1e-141660348
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      WT+eEd +l d ++++G+++W+ Ia+++   ++  qc+ rw++yl
       AA14G00038 16 TWTPEEDVILRDQITLHGTENWAMIASKFK-DKSTRQCRRRWFTYL 60
                     6****************************9.*************97 PP

2Myb_DNA-binding45.41.8e-1466109146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg W++eEd+ll +a + +G++ W+ Ia+ +  gRt++ +k+r+ +
       AA14G00038  66 RGGWSPEEDKLLCEAQRVFGNR-WTEIAKVVS-GRTDNAVKNRFTT 109
                      789*******************.*********.**********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.359960IPR017930Myb domain
SuperFamilySSF466891.27E-2513107IPR009057Homeodomain-like
SMARTSM007171.7E-111362IPR001005SANT/Myb domain
CDDcd001673.81E-111660No hitNo description
PfamPF139211.1E-141777No hitNo description
Gene3DG3DSA:1.10.10.601.4E-201767IPR009057Homeodomain-like
PROSITE profilePS5129421.05261115IPR017930Myb domain
SMARTSM007178.8E-1565113IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.5E-2068114IPR009057Homeodomain-like
CDDcd001671.98E-1069110No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 353 aa     Download sequence    Send to blast
MEIIKKKKKK ERHIVTWTPE EDVILRDQIT LHGTENWAMI ASKFKDKSTR QCRRRWFTYL  60
NSDFKRGGWS PEEDKLLCEA QRVFGNRWTE IAKVVSGRTD NAVKNRFTTL CKKKAKFEAM  120
SEQNRTSNCL NSNNKNMLLI NGEKEAHLPK KMRRSQILVK SCPISVFATS TDPKVTALMQ  180
QAQLLSSLAE RVKEDKTEES MENAWKILQE FLNKGKENEL LRYGVPDMAE FKELVEDLRS  240
SYVENPPFLR QPDLQESPAS SEYSSGSTIL PDQTQQELCT TLTEHKQGEE EFSSPVKVTP  300
LFRSLAADIP SPQFSESEKS FLLKTLGIES SSPCPNVNPS QQPTCKRVLL HSL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-261711510108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3719821e-125AF371982.2 Arabidopsis thaliana putative transcription factor MYB124 (MYB124) mRNA, complete cds.
GenBankBT0261261e-125BT026126.1 Arabidopsis thaliana.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006417021.10.0hypothetical protein EUTSA_v10007659mg
TrEMBLV4KVJ30.0V4KVJ3_EUTSA; Uncharacterized protein
STRINGBra019658.1-P1e-173(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM33742863
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14350.21e-148MYB family protein